DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3473 and Gm3213

DIOPT Version :9

Sequence 1:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_001476050.2 Gene:Gm3213 / 100041224 MGIID:3781392 Length:173 Species:Mus musculus


Alignment Length:143 Identity:98/143 - (68%)
Similarity:117/143 - (81%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKETQRLLEDPVPGISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLT 73
            ||||||||.:|||||:|.|||.:|.||.|::.|.:||||:||.|||||||||:|||.||||.|:|
Mouse    32 IKETQRLLAEPVPGITAEPDENSAHYFPVVIAGTQDSPFDGGTFKLELFLPEEYPMAAPKVCFMT 96

  Fly    74 KIFHPNIDRVGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQ 138
            :|:|||::::.:|  |||||||||||||||||||||.|||||||||||||||||.||.||.:.|:
Mouse    97 EIYHPNVNKLEKI--DILKDKWSPALQIRTVLLSIQPLLSAPNPDDPLANDVAEQWKTNEGQGIE 159

  Fly   139 LARECTLKHAMQN 151
            .....|..:||.|
Mouse   160 TVTAWTRLYAMNN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 97/141 (69%)
COG5078 7..149 CDD:227410 95/139 (68%)
Gm3213XP_001476050.2 UBCc 33..172 CDD:381827 96/140 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1345547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.