DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:140 Identity:53/140 - (37%)
Similarity:65/140 - (46%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKFFIAFALLAIAAIRAAPFHGHEH-------HGHHGGATSHASVHLTSHDDHHEEHHGHHHD 58
            ||.||...|||:|.|:....|.....|       :.....|.:||...|..              
  Fly     1 MAFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAK-------------- 51

  Fly    59 HHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKG 123
               ..:.:|.|.:|.:.|.|:|..:||.|||.|.|.|..|.|.|.||||||:||||.||||...|
  Fly    52 ---AAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPING 113

  Fly   124 FEAHVHREKL 133
            |.|.|:||.|
  Fly   114 FNAVVNREPL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 29/51 (57%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.