DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr76Bb

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:219 Identity:87/219 - (39%)
Similarity:109/219 - (49%) Gaps:60/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FALLAIAAIRAAPFHGHEHHGHHGGATSHASVHLTSHDD--HHEEHHGHHHD------------- 58
            |||| :.|..|||..||        |||::||  |.|:.  |....:|:.||             
  Fly    10 FALL-VGASWAAPHGGH--------ATSYSSV--TKHEGPVHKSLGYGYDHDVVSAYGGIYGHGY 63

  Fly    59 ----HHG-------HDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKR 112
                |.|       |:.||  :.:|.|.|||||..|||.|||.|:|.|..|.|.|.|.::||..|
  Fly    64 PSVGHSGYGYGYDKHEPHH--YPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTR 126

  Fly   113 TVHYTADKHKGFEAHVHREKL-HDHH-QAEHHGHGHSG-YEGGHVEFEEHSSQSGHDYGHGHEEH 174
            .|.||||.|.||.|.|  :|| |.|| |..|.|:||.. |:.              |||:||:..
  Fly   127 VVEYTADDHNGFNAVV--KKLGHAHHPQVYHKGYGHGDIYDA--------------DYGYGHDVA 175

  Fly   175 GHGHGHGHGHGSSSHSY-SLKQEH 197
            .:| |:|:|||..:.|| |:||.|
  Fly   176 QYG-GYGYGHGGHASSYVSVKQLH 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 29/51 (57%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.