powered by:
Protein Alignment Cpr35B and Cpr72Ec
DIOPT Version :9
Sequence 1: | NP_609713.1 |
Gene: | Cpr35B / 34846 |
FlyBaseID: | FBgn0028871 |
Length: | 218 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648884.1 |
Gene: | Cpr72Ec / 39816 |
FlyBaseID: | FBgn0036619 |
Length: | 429 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 37/71 - (52%) |
Gaps: | 5/71 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 GHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFE 125
|:.:...:.|.| .||.:|:.. .:::..||.| |..|.|..:||||..:||.|.|:..:||:
Fly 28 GYQEQDTARAFY--SYGYRDENA--ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFK 87
Fly 126 AHVHRE 131
|....:
Fly 88 AEASNQ 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453295 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.