DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr67B

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:211 Identity:54/211 - (25%)
Similarity:72/211 - (34%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQKFFIAFALLAIAAIRAAPFHGH----EHHGHHGGATSHASVHLTSHDDHHEEHHGHHHDHHGH 62
            ||:|..:..|..|..|..||..|.    |.....|     ..|::....:|.||:...|:|.|  
  Fly    30 AQQFLNSAQLRGIGDIEYAPKTGENPLPEARNEKG-----EFVYMGRVIEHPEEYVEEHYDAH-- 87

  Fly    63 DDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAH 127
             .:|.......|.||.:|...|  |::.....| .|||.|:.:...|.....:|.||| .||...
  Fly    88 -QYHGQDGLGQFAYGYRDWNQG--KNEKRDETG-KVTGSYKYVQPHGRDFVANYYADK-TGFHVE 147

  Fly   128 VHRE--------------KLHDHH------QAEHHGHGHSGY------EGGHVEFEEHSSQSGHD 166
            .:|.              |..:.|      .|...||....|      ||.:...|.......|:
  Fly   148 DNRPAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQPTEPEYQPYVHE 212

  Fly   167 ---YGHGHEEHGHGHG 179
               |..|.||.|...|
  Fly   213 EPPYVPGPEETGEPKG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 16/51 (31%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.