DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and CG13670

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:172 Identity:53/172 - (30%)
Similarity:70/172 - (40%) Gaps:27/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKG 123
            |.|....:.:..||.|.|||:|.||..::::.|:|:|..|.|.|.::|.||..|.|.||||...|
  Fly    90 HDGRTVDYVARPEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANG 154

  Fly   124 FEAHVHR---EKLHDH------------HQAEHH-GHGHSGYEGGHVEFEEHSSQSGH------- 165
            |:|.|..   :.||.|            .|..|| ...|...|....|.|......|:       
  Fly   155 FQAEVITNGVKTLHGHGSDGDAGGGSVDSQVRHHSAEAHKAKEDDEEEDEREREHQGNGQYQVHE 219

  Fly   166 DYGHGHEEHGHGHGHGHGHGSSSHSYSLKQEHGHGHGHSHGQ 207
            ||..|.:|.......|.||    ..|....|.|:....:|.|
  Fly   220 DYDEGKDEQAEEDEEGGGH----QEYEGSSEEGYVEADAHSQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 23/51 (45%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 23/51 (45%)
Paf1 <215..265 CDD:281915 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.