DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:64 Identity:35/64 - (54%)
Similarity:39/64 - (60%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHR 130
            |.|.:|.|.|.|:|..|||.|||.|.|.|..|.|.|.::||||..|||.||||...||.|.|.|
  Fly    37 DPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 28/51 (55%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.