DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr56F

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:190 Identity:42/190 - (22%)
Similarity:73/190 - (38%) Gaps:62/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AIRAAPFHGHEHHGH--HGGATSHASVHLTSHDDHHEEHHGHHHDHHGHDDHHDSHAEYDFQYGV 78
            |:..|.|.|...:|:  :||...:.:    .:....||.:|              .|:|:|:|.|
  Fly    88 ALTGAIFKGGNGNGNGGYGGGNGNGN----GYGQRDEEQYG--------------PAKYEFKYDV 134

  Fly    79 KDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHREKLHDHHQAEHHG 143
            :|.::|:.....|||.|....|.|.::..||.|:.|.|.||                        
  Fly   135 QDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEAD------------------------ 175

  Fly   144 HGHSGYEGGHVEFEEHSSQSGHDYGHGHEEHGHGHGHGHGHGSSSHSYSLKQEHGHGHGH 203
                              |:|:.....:|:.|:|:|:|:|:|.:...|....:.|..:|:
  Fly   176 ------------------QNGYRPTIRYEQVGNGNGNGNGNGRNGGGYDSNAQQGKFNGY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 19/51 (37%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.