DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr51A

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:199 Identity:45/199 - (22%)
Similarity:63/199 - (31%) Gaps:65/199 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FIAFALLAIAAIRAAPFHGHEHHGHHGGATSHASVHLTSHDDHHEEHHGHHHDHHGHDDHHDSHA 70
            |:..|.|.:|...|||                          ..:|......:...::.:.:.:|
  Fly     4 FVLIASLLVALCMAAP--------------------------PRQESEAERIEREEYEKYQNENA 42

  Fly    71 EYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGH-KRTVHYTADKHKGFEAHVHREKLH 134
            :|.|...|.|:......|::|.|.|.||.|.|...  ||. ||.|.|.||| .|:..      |.
  Fly    43 QYSFNSSVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEYIADK-DGYRV------LK 98

  Fly   135 DHHQAEHHGHGHSGYEGGHVEFEEHSSQSGHDYGHGHEEHGHGHGHGHGHGSSSHSYSLKQEHGH 199
            |  :.|..|:|.|....|....|                           ||....||:|.:...
  Fly    99 D--EIEDVGNGPSFNPDGIANVE---------------------------GSMIGKYSIKLDKAD 134

  Fly   200 GHGH 203
            ...|
  Fly   135 DDKH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 21/52 (40%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:278791 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.