DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr50Ca

DIOPT Version :10

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:157 Identity:41/157 - (26%)
Similarity:58/157 - (36%) Gaps:44/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HGHE-HHGHHGGATSHASVHLTSHDDHH---------------EEHHGHHHDHHG---------- 61
            |||. .:|:.|...:...|....|..||               ::||.|...|||          
  Fly   660 HGHGLSNGYEGVTNAEEPVTTVEHVVHHPTVATQLHHQVLLPKQQHHHHQQQHHGLVATVLPAEL 724

  Fly    62 ------------HDDHHDS----HAEYDFQYGVKDQKTGDVKSQSESRHGHTVT-GHYELIDADG 109
                        :.|...|    .::|:|.|.::|..||:.....::|..|.|| |.|.::..||
  Fly   725 DSDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDG 789

  Fly   110 HKRTVHYTADKHKGFEAHVHREKLHDH 136
            ..:.|.|.|| ..||.|.|..|....|
  Fly   790 RIQNVIYHAD-DTGFHADVSFEGATKH 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 18/52 (35%)
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.