DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr30B

DIOPT Version :10

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:60 Identity:36/60 - (60%)
Similarity:42/60 - (70%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 YDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHRE 131
            |:||:.|.|..|||:|||.|||....|.|.|||||:||::|.|.|.||.|.||||.|.||
  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQRE 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 29/51 (57%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.