DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr30F

DIOPT Version :10

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:67 Identity:38/67 - (56%)
Similarity:47/67 - (70%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHRE 131
            ::.|.|||.|.|.|:.|||:|||:|||.|..|.|.|.|:||||:.|||.||:|.|.||.|.|.|:
  Fly    40 EAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRD 104

  Fly   132 KL 133
            .|
  Fly   105 PL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 31/51 (61%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.