DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr35B and Cpr30F

DIOPT Version :9

Sequence 1:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:67 Identity:38/67 - (56%)
Similarity:47/67 - (70%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFEAHVHRE 131
            ::.|.|||.|.|.|:.|||:|||:|||.|..|.|.|.|:||||:.|||.||:|.|.||.|.|.|:
  Fly    40 EAPAHYDFAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRD 104

  Fly   132 KL 133
            .|
  Fly   105 PL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 31/51 (61%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466425
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.