DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk and ppk15

DIOPT Version :9

Sequence 1:NP_477232.1 Gene:ppk / 34843 FlyBaseID:FBgn0020258 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001097937.1 Gene:ppk15 / 43188 FlyBaseID:FBgn0039424 Length:483 Species:Drosophila melanogaster


Alignment Length:559 Identity:117/559 - (20%)
Similarity:191/559 - (34%) Gaps:162/559 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EYAKSTTIHGIRYIFEVHRPIYEKLYWLFFTCISVYFAVSLIWDTYLKWQESPVILGFDETLVPV 132
            :|..:.|:.|..||........|:::||....:|......||......:....|.:.: |:|.|.
  Fly    26 DYCTNCTLAGFAYIANSRLHFMERIFWLICVFMSSLGCYQLIMGYQRSFPTRAVSIVY-ESLPPF 89

  Fly   133 HKIPFPTITICPEIKMERNVF----------------DY-----TNVSRQLWEE-YKQNG----- 170
            .|..||.:::| |:....|:|                ||     |.||..|:.. |.:||     
  Fly    90 SKWKFPAVSVC-ELAYRGNLFPKFEEYITSLGVDVTGDYPYDVETGVSILLFPALYNENGLKGKC 153

  Fly   171 -----NISDLDDEDLARMAVAMHICDSEVVQRFTPLLSQLNPPNVDVTQTLIDLSISKNETGPFC 230
                 |.:|           |...|.|:   .:..:|:...       ....||.:.       |
  Fly   154 GTVHKNCTD-----------ACAKCPSD---NYRQILTWYG-------ANCSDLFVE-------C 190

  Fly   231 KWNGRFYFCDKIFDFVATDEGICYQFNGLRPKDIYRDEKFISYVDPDVVDFNKYFDVDLPPWNNI 295
            |.:...:.|.:.|..:.|..|.||..|.|                                .||.
  Fly   191 KLSHEPFDCCRHFLPLLTPFGRCYMLNSL--------------------------------LNNE 223

  Fly   296 TG--NW---SLDTGFVDQGQNAYPQRTVFSSVKNGFFAFLQGLQHNFDYDCRSFKQGYKVFLNSP 355
            .|  :|   .||........|...:..|..||.|.     :.:.|...:               |
  Fly   224 PGSKHWLPNELDPAHQKAVINVITRLDVQISVINA-----EDIPHTAFF---------------P 268

  Fly   356 ESVPLTTGNYILVPHGDEVLVSVLPAYVVSTDNLHEITPEKRQCLFDDE---RSLRFFRSYSQSN 417
            ..:||.|.........::|.:...|       ::.:|.|:.|.|.|.:|   .||  ::|||.|.
  Fly   269 PGIPLITEGLSKYMQFNQVAMKNDP-------DVKDIDPKIRSCFFPEEIPADSL--YKSYSFSV 324

  Fly   418 CQTECLANYTVSKCGCAKFWM-----PKPLGTPVCGLKDINCYTSA---QDELYTLMQNQTMAKS 474
            |.|||:....:..|.|..|..     |:   .|.|.|:...|....   :.:...|:.|      
  Fly   325 CITECIRRLQMKACNCTSFLYNPNADPR---YPDCDLEGFLCLEKTRMIKPDSRVLVNN------ 380

  Fly   475 IDESVDITCNCMPACTSLEYNFEISRAKYDVAKTIRAFREEYEHTDAIGSRLSVYFKEHQFTAIK 539
             ::..:.:|.|:|:|...:..     ..|:....:|...:.|.     |:....:....|:   :
  Fly   381 -NKGNNASCGCLPSCNDGDIT-----TIYEPLLFVRNPNKYYN-----GTLDMPFLPTDQY---R 431

  Fly   540 RTILFGVSTLISNCGGICGLFMGISCLSFLELIYFFCMR 578
            |..|.....::.:.||:.|||:|.|.||.:|.:|:|.:|
  Fly   432 RQSLRTPLDVVVSMGGMLGLFLGASILSAIEFVYYFTVR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppkNP_477232.1 ASC 69..574 CDD:279230 114/552 (21%)
ppk15NP_001097937.1 ASC 27..466 CDD:279230 114/552 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
54.920

Return to query results.
Submit another query.