DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk and ppk23

DIOPT Version :9

Sequence 1:NP_477232.1 Gene:ppk / 34843 FlyBaseID:FBgn0020258 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:616 Identity:141/616 - (22%)
Similarity:227/616 - (36%) Gaps:208/616 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EYAKSTTIHGIRYIFEVHRPIYEKLYWLFFTCISVYFAVSLIWDTYLKWQESPVILGFDETLVPV 132
            |:.:::|:||:|||.|..|||.||..|..||.|....|:.:|...:.|:|.:|.|.|.| |....
  Fly    33 EFFQNSTLHGVRYIAESGRPIGEKFMWFCFTSIGAVTALVIIMSLWEKFQTNPTITGLD-TDFHN 96

  Fly   133 HKIPFPTITICPEIKMERNVFDYTNVSRQLWEEYKQNGNISDLDDEDLARMAVAMHICDSEVVQR 197
            ..:.|||..:|||.     .||:.....:::      ..:::.|:..               .|.
  Fly    97 QNVVFPTTVVCPEA-----AFDHDKTYEKVY------NTLANYDEAQ---------------AQM 135

  Fly   198 FTP---LLSQLNPPNV--------DVTQTLIDL----------SISKNETGPFCKWNGRFYFCDK 241
            :||   :|:.||..||        .:.|.|:|.          .|........||:......|..
  Fly   136 YTPFLRILTSLNFENVRDAKVLSQSIPQNLLDAHTIREWAFEGHIDCKNVFVSCKYRDEDIPCCD 200

  Fly   242 IFDFVATDEGICYQFNGL------------RPKDIYR-DEKFISYVDPD------VVDFNKYFDV 287
            .|:.:.|:.|.||.||..            .|.|:|. |:|:..:..|:      :....:||..
  Fly   201 HFEPIYTEHGFCYAFNSRFKSTPTEDVKTGAPHDLYETDKKWALFFIPNSTSRIFIFSNEEYFGS 265

  Fly   288 DLPPWNNITGNWSLDTGFVDQGQNAYPQRTVFSSVKNGFFAFLQGLQHNFDYDCRSFKQGYKVFL 352
            |.    |...:||                                                    
  Fly   266 DF----NAQIDWS---------------------------------------------------- 274

  Fly   353 NSPESVPLTTGNYILVPHGDEVLVSVLPAYVVSTDNLHEITPEKRQCLFDDERSLRFF-RSYSQS 416
             .|:.|              ||.:|....|  :||:..:::..:|:|:|.||..|.:| .:|:.|
  Fly   275 -EPQLV--------------EVRISKKNTY--TTDDARQLSIGQRKCIFSDEVKLNYFPDAYTFS 322

  Fly   417 NCQTECLANYTVSKCGC-AKFWMP------------------------KPLGTPVCGLKDINCYT 456
            :|..:|..|..:..|.| ..|:.|                        .....|:|.:||.:|. 
  Fly   323 SCMKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDFDCL- 386

  Fly   457 SAQDELYTLMQNQTMAKSIDESVDITCNCMPACTSLEYNFEISRAKYDVAKTIRAFREEYEHTDA 521
               ||.          ||...::.....|..:|         |:..:::.|.|:.    .:..::
  Fly   387 ---DEF----------KSNITNIKDCLQCELSC---------SKTVFNIDKLIKM----SDRPES 425

  Fly   522 IGSRLSVYFKEHQFTAIKRTILFGVSTLISNCGGICGLFMGISCLSFLELIYFFCMRICGSC--- 583
            :|  :.|.|........||.:|||...|:.:.|||..||:|.|.||.:|:||:|.:|.|  |   
  Fly   426 LG--VLVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRAC--CMVY 486

  Fly   584 RDRR-----KHKIQQQ--NSVDLP-EEKSEN 606
            ::|:     :.||:|:  ..:||. ..||.|
  Fly   487 KNRQELYEIEEKIRQEPPPKIDLKLSLKSHN 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppkNP_477232.1 ASC 69..574 CDD:279230 126/570 (22%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 126/570 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.