DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk and egas-3

DIOPT Version :9

Sequence 1:NP_477232.1 Gene:ppk / 34843 FlyBaseID:FBgn0020258 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:465 Identity:83/465 - (17%)
Similarity:160/465 - (34%) Gaps:130/465 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QLWEEYKQNGNISDLDDEDLARMAVAMHICDSEVVQRFTPLLSQLNP----------PNVDVTQT 215
            :.|:..|...|..|    |:|.....::.......:::|..|..||.          .:||:|..
 Worm   524 EAWKWIKSPCNSKD----DMANCTKKINGFTCSCGEKWTDTLCDLNVLIKDVLMAIYGHVDLTMI 584

  Fly   216 LIDLSISKN-----ETGPF------------CKWNGRFYFCDKIFDFVATDEGICYQFNGLRPKD 263
            .:...:.:|     :..||            ..|:     ...:|:::|                
 Worm   585 TLLNDLMQNPSQIKDMVPFITGLLTDSERSDLSWD-----AGDLFNWIA---------------- 628

  Fly   264 IYRDEKFISYVDPDVVDFNKYFDVDLPPWNNIT-GNWSLDTGFVDQGQN-AYPQRTVFSSVKNGF 326
             :.|::         :|.|:    |:..||::. ||...   |..:.:| .|..|.  .....|.
 Worm   629 -FEDQR---------LDLNR----DIHKWNDVVLGNCFT---FNHRDRNFTYLMRR--PGRHGGI 674

  Fly   327 FAFLQGLQHNFD--YDCRSFKQGYKVFLNS------PESVPLTTGNYILVPHGDEVLVSVLPAYV 383
            .||::..|..:.  ||..:.    .||:::      .|||     .|...|:....:...:..|.
 Worm   675 QAFMKTRQDEYAPWYDTAAI----NVFIHNRDDYVFSESV-----RYNAQPNAQSTINIFMTRYT 730

  Fly   384 VSTDNLHEITPEKRQCLFDDERSLRFF--RSYSQSNCQTECLANYTVSKCGCAKFWMPKPLGTPV 446
            ....|.       .:|:........::  .:|:...|...|..:....:|.|.....|:...:..
 Worm   731 RLGGNY-------GKCIKKPSEVKNYYYPGAYTTDGCLRTCYQDRMKEECNCMDPRYPQAPNSTS 788

  Fly   447 CGLKDINCYTSAQDELYTLMQNQTMAKSIDESVDITCNCMPACTSLEYNFEISRAKY-------- 503
            |.|.:.:|.|.|.:            .:.|.|...:|.|...|::.||:...|:|.:        
 Worm   789 CQLSERSCVTEASE------------AAGDPSTWSSCVCPLPCSNQEYSVTWSKANFVNLPITCE 841

  Fly   504 ---DVAKTIRAFREEYEHTDAIGSRLSVYFKEHQFTAIKRTILFGVSTLISNCGGICGLFMGISC 565
               |||...:.::::.        .:|:...:..|.....|.....:..:|..||..|:.|||:.
 Worm   842 KSSDVATCQKQYKDQL--------MVSIILPQLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINV 898

  Fly   566 LSFLELIYFF 575
            ::|:|:::.|
 Worm   899 VTFIEVVFLF 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppkNP_477232.1 ASC 69..574 CDD:279230 82/462 (18%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 57/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.