DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and YPT7

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:77/213 - (36%)
Similarity:119/213 - (55%) Gaps:20/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVD-DKKIKLQIWDTAGQERFR 98
            |.|.||:||.||||:.|:|::...|:......|||.:|.|:.:.|| ||...:|:|||||||||:
Yeast     8 ILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQ 72

  Fly    99 AVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTD---TRNLTNPSTVIFLI-GNKSDLESTREVT 159
            ::..::||||...::|||:|..|::.::.||..:   ..|:.:|.|..|:| |||.|.|.::::.
Yeast    73 SLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIV 137

  Fly   160 YEE-AKEFADENG--LMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQP 221
            .|: |:|.|...|  .:|| .||....||:.||.|.||..   :|:.:.|..|.|...       
Yeast   138 SEKSAQELAKSLGDIPLFL-TSAKNAINVDTAFEEIARSA---LQQNQADTEAFEDDY------- 191

  Fly   222 SRTSLSSEATGAKDQCSC 239
             ..:::....|..:.|||
Yeast   192 -NDAINIRLDGENNSCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 69/171 (40%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 69/176 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.