DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RABA5E

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_563750.3 Gene:RABA5E / 837091 AraportID:AT1G05810 Length:264 Species:Arabidopsis thaliana


Alignment Length:207 Identity:95/207 - (45%)
Similarity:128/207 - (61%) Gaps:9/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFR 98
            |:||.::|||..||||.||.::...:|.||...||||||.|:.:|::.|::|.||||||||||||
plant    57 YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAGQERFR 121

  Fly    99 AVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEA 163
            |||.:|||||.|||:|||||||:|:..:..||.:.:..::.:....|:|||.|||:.|.|:.||.
plant   122 AVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLENIRAVSVEEG 186

  Fly   164 KEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRL--DLNASESGVQHRPSQPSRTSL 226
            |..|:|.||.|:|.||:...||:.||......||.|:...:|  |....|..|       :|.||
plant   187 KALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDELTV-------NRVSL 244

  Fly   227 SSEATGAKDQCS 238
            ..:...|..|.|
plant   245 VKDDNSASKQSS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 84/164 (51%)
RABA5ENP_563750.3 Rab11_like 56..220 CDD:206660 82/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.