DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RABA4C

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_199607.1 Gene:RABA4C / 834847 AraportID:AT5G47960 Length:223 Species:Arabidopsis thaliana


Alignment Length:240 Identity:104/240 - (43%)
Similarity:144/240 - (60%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKVRSVVNKLHERIDYFIEKCPNMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCP 65
            |||.:|..|   ::||                 |:||.::|||..||||.||.:|:..:|.....
plant     1 MSKFQSNFN---QKID-----------------YVFKVVLIGDSAVGKSQLLARFSRNEFSIESK 45

  Fly    66 HTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWL 130
            .||||||.||.:|:|.|.||.||||||||||:||||.:|||||.||::|||||:|.:::|::.||
plant    46 ATIGVEFQTRTLEIDRKTIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWL 110

  Fly   131 TDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARK 195
            .:.|...:.:.||.|||||:||.:.|.|..|:|||||....|.|:|.||:...|||.:||....:
plant   111 EELRGHADKNIVIMLIGNKTDLGTLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTE 175

  Fly   196 IYQNIQEGRLDLN-ASESGVQHRPSQPSRTSLSSEATGAKDQCSC 239
            ||:.:.:..|..| ..|||......|.::..::.|.|.:|.:..|
plant   176 IYRIVSKKNLVANEEGESGGDSSLLQGTKIVVAGEETESKGKGCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 87/164 (53%)
RABA4CNP_199607.1 Rab11_like 13..177 CDD:206660 86/180 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.