DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RABA1c

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_199387.1 Gene:RABA1c / 834614 AraportID:AT5G45750 Length:216 Species:Arabidopsis thaliana


Alignment Length:208 Identity:99/208 - (47%)
Similarity:138/208 - (66%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
            |:|:||.::|||.|||||.||.:||:.:|......||||||.||.:.||||.||.||||||||||
plant    10 YDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQER 74

  Fly    97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
            :||:|.:|||||.|||:|||:||.||:.::.:||.:.||.|:|:.|:.|:||||||.....|..|
plant    75 YRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLRHLVAVQTE 139

  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL 226
            :||.||::..|.|:|.||:...|||.||.|...:|:..:.:..::. ||||.  :.||:..:..:
plant   140 DAKSFAEKESLYFMETSALEATNVENAFAEVLTQIHHIVSKKAMEA-ASESA--NVPSKGDKIDI 201

  Fly   227 SSEATGAKDQCSC 239
            ..:.:..|....|
plant   202 GKDVSAVKKGGCC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 90/164 (55%)
RABA1cNP_199387.1 Rab11_like 11..175 CDD:206660 89/163 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.