DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RAB8C

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_195972.1 Gene:RAB8C / 831817 AraportID:AT5G03520 Length:216 Species:Arabidopsis thaliana


Alignment Length:218 Identity:90/218 - (41%)
Similarity:132/218 - (60%) Gaps:11/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MTAAP----YNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIK 85
            |..||    .:|:|:.|.::|||.||||||||.:|::..|..:...|||::|..|.:|:|.|:||
plant     1 MAVAPARARSDYDYLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIK 65

  Fly    86 LQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKS 150
            |||||||||||||.:|.:|||||.|.|:|||:|..|::|::.:|:.:.....:.:....|:|||:
plant    66 LQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDNVNKILVGNKA 130

  Fly   151 DL-ESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGV 214
            |: ||.|.|...:.:..|||.|:.|.|.||.|..|||..|:..|:.|.|.:.|  .|..|...|:
plant   131 DMDESKRAVPTAKGQALADEYGIKFFETSAKTNLNVENVFMSIAKDIKQRLTE--TDTKAEPQGI 193

  Fly   215 QHRPSQPSRTSLSSEATGAKDQC 237
            :    ...:.:.:|.:|..|..|
plant   194 K----ITKQDTAASSSTAEKSAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 77/165 (47%)
RAB8CNP_195972.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 77/166 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.