DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and GB2

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_195311.1 Gene:GB2 / 829740 AraportID:AT4G35860 Length:211 Species:Arabidopsis thaliana


Alignment Length:185 Identity:121/185 - (65%)
Similarity:146/185 - (78%) Gaps:0/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95
            :|:|:||||||||.||||||||.|||:|:|......|||||||.|::.||.:.||||||||||||
plant     2 SYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTVDGRPIKLQIWDTAGQE 66

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160
            .||::||||||||||||:|||||||.|:|||:|||.|.|...||:..|.|||||.||...|.|:.
plant    67 SFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMSIMLIGNKCDLAHKRAVSK 131

  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQ 215
            ||.::||.|:||:||||||.|.|||||||:|||.||.||||:|..|::...||::
plant   132 EEGQQFAKEHGLLFLEASARTAQNVEEAFIETAAKILQNIQDGVFDVSNESSGIK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 112/164 (68%)
GB2NP_195311.1 PLN03108 1..210 CDD:178655 121/185 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.