DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RABA1g

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_188124.1 Gene:RABA1g / 820735 AraportID:AT3G15060 Length:217 Species:Arabidopsis thaliana


Alignment Length:208 Identity:96/208 - (46%)
Similarity:133/208 - (63%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95
            :|::::|.::|||.|||||.||.:||..:|......||||||.||.|.||:|.:|.|||||||||
plant     9 DYDFLYKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAGQE 73

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160
            |:||:|.:|||||.|||:|||:||..|:.::..||.:.|:.|..:.||.|:|||:||...|.|:.
plant    74 RYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLRHLRAVST 138

  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTS 225
            |:||.||:.....|:|.||:...|||.||.|...:||:...:..||:     |..| .:.|...|
plant   139 EDAKAFAERENTFFMETSALEALNVENAFTEVLSQIYRVASKKALDI-----GDDH-TTLPKGQS 197

  Fly   226 LSSEATGAKDQCS 238
            ::   .|:||..|
plant   198 IN---VGSKDDVS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 85/164 (52%)
RABA1gNP_188124.1 Rab11_like 11..175 CDD:206660 83/163 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.