Sequence 1: | NP_788056.1 | Gene: | Rab14 / 34840 | FlyBaseID: | FBgn0015791 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766189.1 | Gene: | Rab2b / 76338 | MGIID: | 1923588 | Length: | 216 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 118/195 - (60%) |
---|---|---|---|
Similarity: | 151/195 - (77%) | Gaps: | 0/195 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
Fly 97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
Fly 162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL 226
Fly 227 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab14 | NP_788056.1 | Rab14 | 34..199 | CDD:133322 | 109/164 (66%) |
Rab2b | NP_766189.1 | PLN03108 | 1..216 | CDD:178655 | 118/195 (61%) |
Rab2 | 3..170 | CDD:206658 | 110/166 (66%) | ||
Effector region. /evidence=ECO:0000250 | 35..43 | 4/7 (57%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 189..216 | 3/9 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |