DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab13

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_080953.1 Gene:Rab13 / 68328 MGIID:1927232 Length:202 Species:Mus musculus


Alignment Length:206 Identity:81/206 - (39%)
Similarity:127/206 - (61%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
            |:::||.::|||.||||:||:.:|.|..|.:....|||::|..|.::::.|:||||:||||||||
Mouse     5 YDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQER 69

  Fly    97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
            |:.:|.:|||||.|.::|||||...::.::.:|:...:...:......|:|||.|:|:.|:|..|
Mouse    70 FKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQRE 134

  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL 226
            :|::.|.|:.:.|.|.||.:..||:|||...||.|.       |......||..   |:||.|.|
Mouse   135 QAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDIL-------LKTGGRRSGTN---SKPSSTGL 189

  Fly   227 SSEATGAKDQC 237
            .: :...|::|
Mouse   190 KT-SDKKKNKC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 70/164 (43%)
Rab13NP_080953.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 70/172 (41%)
RAB 9..170 CDD:197555 69/160 (43%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..202 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.