Sequence 1: | NP_788056.1 | Gene: | Rab14 / 34840 | FlyBaseID: | FBgn0015791 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080953.1 | Gene: | Rab13 / 68328 | MGIID: | 1927232 | Length: | 202 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 81/206 - (39%) |
---|---|---|---|
Similarity: | 127/206 - (61%) | Gaps: | 11/206 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
Fly 97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
Fly 162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL 226
Fly 227 SSEATGAKDQC 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab14 | NP_788056.1 | Rab14 | 34..199 | CDD:133322 | 70/164 (43%) |
Rab13 | NP_080953.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 70/172 (41%) |
RAB | 9..170 | CDD:197555 | 69/160 (43%) | ||
Effector region. /evidence=ECO:0000250 | 37..45 | 3/7 (43%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 174..202 | 9/30 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |