DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab6ba

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_005165989.1 Gene:rab6ba / 558900 ZFINID:ZDB-GENE-050809-136 Length:258 Species:Danio rerio


Alignment Length:210 Identity:72/210 - (34%)
Similarity:117/210 - (55%) Gaps:21/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAV 100
            ||.:.:|:..|||:.|:.:|....|......|||::|.::.:.::|:.::||:||||||||||::
Zfish    64 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 128

  Fly   101 TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 165
            ..||.|.:..|::|||||..:::...|.|:.|.|.......:|.|:|||:||...|::|.||.::
Zfish   129 IPSYIRDSTVAVVVYDITNVNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLADKRQITIEEGEQ 193

  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETA------RKIYQNIQEGRLDLNASESGVQHRPSQPSRT 224
            .|.|..:||:|.||.||.||::.|...|      ..:.:..:||.:|:...      :|.:|..|
Zfish   194 RAKELSVMFIETSAKTGYNVKQLFRRVAAALPGMESMQETSKEGMIDIKLD------KPQEPPTT 252

  Fly   225 SLSSEATGAKDQCSC 239
                     :..|||
Zfish   253 ---------EGGCSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 63/168 (38%)
rab6baXP_005165989.1 Rab6 64..224 CDD:206654 63/159 (40%)
RAB 64..221 CDD:197555 62/156 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.