DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab42b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001017683.2 Gene:rab42b / 550378 ZFINID:ZDB-GENE-050417-172 Length:218 Species:Danio rerio


Alignment Length:213 Identity:84/213 - (39%)
Similarity:128/213 - (60%) Gaps:5/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVD-DKKIKLQIWDTAGQE 95
            :.|.|:.|::||..||||.:|.::||..|:.....|:||:|....:||: ..::|||.|||||||
Zfish     6 WQYQFRIIMLGDSTVGKSSMLKRYTEDLFLECINQTVGVDFYVHFLEVEPGVRVKLQFWDTAGQE 70

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF-LIGNKSD--LESTRE 157
            |||:|||||||.:.|.|:|:|:..|.::.::..|..:.....:|.||:| |:|:|||  ....|.
Zfish    71 RFRSVTRSYYRNSVGGLLVFDLGNRKSFENVREWYAEVCERVHPYTVLFVLVGHKSDRVKGGERA 135

  Fly   158 VTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQ-HRPSQP 221
            |...||::.|.:.|..::||||.||.||:|||....|:|||.::.|.:.|.....||: ..|:..
Zfish   136 VDRTEAEKLASQLGAPYIEASAKTGHNVKEAFDLLTRRIYQGLKSGEIQLREGWDGVKSSAPTAQ 200

  Fly   222 SRTSLSSEATGAKDQCSC 239
            :...|.:..:..|..|:|
Zfish   201 TLQKLQNNESAEKKSCTC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 74/168 (44%)
rab42bNP_001017683.2 P-loop_NTPase 8..218 CDD:304359 83/209 (40%)
RAB 10..176 CDD:197555 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.