DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab4b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_031746337.1 Gene:rab4b / 549741 XenbaseID:XB-GENE-946075 Length:234 Species:Xenopus tropicalis


Alignment Length:209 Identity:122/209 - (58%)
Similarity:152/209 - (72%) Gaps:3/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERF 97
            :::||:::||..|.|||||||||.|.||..:..||||||||:||:.|..|.:|||||||||||||
 Frog    27 DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGKSVKLQIWDTAGQERF 91

  Fly    98 RAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEE 162
            |:|||||||||||||:||||..|.|||.|::||||.|.|.:|:.:|.|.|||.||::.||||:.|
 Frog    92 RSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNIIIILCGNKKDLDADREVTFLE 156

  Fly   163 AKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSLS 227
            |..||.||.|||||.||:||:|||||||:.||.|...|:.|.||.....||:|:..:.| |.:..
 Frog   157 ASRFAQENELMFLETSALTGENVEEAFLKCARTILSKIESGELDPERMWSGIQYGDASP-RHAKH 220

  Fly   228 SEATGA--KDQCSC 239
            |..|..  :.||:|
 Frog   221 SHGTQQQNRQQCNC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 108/164 (66%)
rab4bXP_031746337.1 Rab4 30..190 CDD:206696 107/159 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.