DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab14

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001007505.1 Gene:rab14 / 493231 XenbaseID:XB-GENE-479093 Length:215 Species:Xenopus tropicalis


Alignment Length:215 Identity:175/215 - (81%)
Similarity:194/215 - (90%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIW 89
            |..|||||:|||||||||||||||||||||||||||||:||||||||||||||||..:|||||||
 Frog     1 MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIW 65

  Fly    90 DTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLES 154
            |||||||||||||||||||||||||||||||||||||||||||.||||||:|||.|||||:|||:
 Frog    66 DTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEA 130

  Fly   155 TREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPS 219
            .|:|||||||:||:||||:||||||.||:|||:||||.|:|||||||:|.|||||:||||||:||
 Frog   131 QRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPS 195

  Fly   220 QPSRTSLSSEATGAKDQCSC 239
            .|....|:||....::.|.|
 Frog   196 APQGGRLTSEPQPQREGCGC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 145/164 (88%)
rab14NP_001007505.1 Rab14 10..175 CDD:133322 145/164 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 294 1.000 Domainoid score I1480
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I2124
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1146851at2759
OrthoFinder 1 1.000 - - FOG0001311
OrthoInspector 1 1.000 - - oto105583
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X808
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.