DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and zgc:100918

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001005591.1 Gene:zgc:100918 / 449549 ZFINID:ZDB-GENE-040927-2 Length:205 Species:Danio rerio


Alignment Length:210 Identity:74/210 - (35%)
Similarity:119/210 - (56%) Gaps:17/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRA 99
            :.|.||:||.||||:.|::|:..|||......|||.:|.|:.:.|||:.:.:|||||||||||::
Zfish     8 LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQS 72

  Fly   100 VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTD---TRNLTNPSTVIFLI-GNKSDLESTREVTY 160
            :..::||||...::|||:|..:|:..|.||..:   ..:..:|....|:: |||.|||: |:||.
Zfish    73 LGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLEN-RQVTT 136

  Fly   161 EEAKEFA-DENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRT 224
            :.|:.:. .::.:.:.|.||....||::||...||...:  ||..::.......::.|..:|   
Zfish   137 KRAQAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALK--QESEVETYDFPDQIKLRDDRP--- 196

  Fly   225 SLSSEATGAKDQCSC 239
                  ..:.|.|||
Zfish   197 ------VSSGDGCSC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 66/168 (39%)
zgc:100918NP_001005591.1 Rab7 9..179 CDD:206655 68/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.