DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab34

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001006769.1 Gene:rab34 / 448455 XenbaseID:XB-GENE-494108 Length:259 Species:Xenopus tropicalis


Alignment Length:215 Identity:74/215 - (34%)
Similarity:110/215 - (51%) Gaps:18/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHERIDYFIEK----CPNMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVE 71
            ||.| :.|..|    |.........|. |.|.|::||:.|||:||:::|.:..|..|...||||:
 Frog    26 LHTR-ESFHSKVTSACKQQRTGTVGYK-ISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVD 88

  Fly    72 FGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNL 136
            |.....|:......||:|||||||||:.:..:|||||...::.:|:|..|:..|...||.|....
 Frog    89 FEMERFEILGVPFSLQLWDTAGQERFKCIASTYYRGAQAIIIAFDLTDVSSLEHTKQWLQDALKE 153

  Fly   137 TNPST-VIFLIGNKSDLESTREVTYEE------AKEFADENGLMFLEASAMTGQNVEEAFLETAR 194
            .:||: ::||:|:|.||....:....|      |||...|    :...|::||:||:|.|...|.
 Frog   154 NDPSSALLFLVGSKKDLSPPAQYALMEKDAIKVAKEMQAE----YWSVSSLTGENVKEFFFRVAS 214

  Fly   195 KIYQNIQEGRLD-LNASESG 213
            ..:::.....|: .||...|
 Frog   215 LTFESSVLAELEKTNARRIG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 63/171 (37%)
rab34NP_001006769.1 Rab36_Rab34 53..219 CDD:206693 62/169 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.