DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab2b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001005636.1 Gene:rab2b / 448102 XenbaseID:XB-GENE-920598 Length:215 Species:Xenopus tropicalis


Alignment Length:214 Identity:124/214 - (57%)
Similarity:155/214 - (72%) Gaps:7/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95
            :|.|:||||||||.||||||||.|||:|:|......|||||||.|:|.:|.|.||||||||||||
 Frog     2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGKPIKLQIWDTAGQE 66

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160
            .||::||||||||||||:|||||||.|::||:|||.|.|..::.:.||.||||||||||.|:|:.
 Frog    67 SFRSITRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNMVIILIGNKSDLESRRDVSR 131

  Fly   161 EEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTS 225
            ||.:.||.|:||:|:|.||.|..||||||::||::||:.||:|..|:|...:|::..|.|.....
 Frog   132 EEGEAFAREHGLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLFDVNNEANGIKVGPQQSINEP 196

  Fly   226 LSS-------EATGAKDQC 237
            |.|       |..|....|
 Frog   197 LGSGLRQNQNEGGGTSGCC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 110/164 (67%)
rab2bNP_001005636.1 PLN03108 1..215 CDD:178655 123/212 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.