DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab18

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:190 Identity:78/190 - (41%)
Similarity:113/190 - (59%) Gaps:17/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVT 101
            |.::||:.|||||.|:.:|.|.||..|...|||::|.:::::||....|:.:|||||.||||::|
  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSLT 71

  Fly   102 RSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLT-NPSTVIFLIGNKSDLESTREVTYEEAKE 165
            .|:||.|.||::|||||.|.:...|.:||.:..:.: ||:..|.::|||.|.|  |.|..||.::
  Fly    72 PSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE--RVVDREEGRK 134

  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETARKI----YQN---------IQEGRLDLNASES 212
            ||.::..:|:|.||...|.|.:.|.:...||    |.|         |...| ||.||.|
  Fly   135 FARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDR-DLEASAS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 70/166 (42%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 68/160 (43%)
Rab18 6..165 CDD:206656 67/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.