DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab-11.2

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001251691.1 Gene:rab-11.2 / 4363014 WormBaseID:WBGene00004275 Length:198 Species:Caenorhabditis elegans


Alignment Length:206 Identity:95/206 - (46%)
Similarity:122/206 - (59%) Gaps:15/206 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQER 96
            |.|:||.::||:.|||||.||.:||..:|......||||||.|:||.|:.|.:|:|||||||.||
 Worm     5 YYYLFKIVLIGNPGVGKSNLLSRFTRNEFNLKSKPTIGVEFATKIISVEGKAVKVQIWDTAGMER 69

  Fly    97 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYE 161
            ||....||||||.|||:||||::..||..:..||...|:..|...||.|:||||||  :..|..:
 Worm    70 FRCGASSYYRGALGALLVYDISKHKTYESVEQWLKVLRDHANEDIVITLVGNKSDL--SHAVPTD 132

  Fly   162 EAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSL 226
            |||.:|:.|.:.|:|.||:...|||.||.....:||:.:.|...|    .||. ..||..|.|  
 Worm   133 EAKIYAERNHISFIETSALDNTNVEAAFTNIVTEIYKLVSEKYKD----HSGT-IIPSTASNT-- 190

  Fly   227 SSEATGAKDQC 237
                  .|:||
 Worm   191 ------PKNQC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 83/164 (51%)
rab-11.2NP_001251691.1 Rab11_like 7..168 CDD:206660 81/162 (50%)
RAB 9..170 CDD:197555 82/162 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.