DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab1

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster


Alignment Length:203 Identity:88/203 - (43%)
Similarity:128/203 - (63%) Gaps:4/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIW 89
            |::....|:|:||.::|||.||||||||.:|.:..:..:...||||:|..|.||:|.|.||||||
  Fly     1 MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIW 65

  Fly    90 DTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLES 154
            |||||||||.:|.||||||.|.::|||.|.:.::|::..||.:.......:....|:||||||.:
  Fly    66 DTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTT 130

  Fly   155 TREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNI--QEGRLDLNASESGV-QH 216
            .:.|.:..|.|:|.:.|:.|||.||.:..|||:||:..|.:|...:  .....| |||:..: |.
  Fly   131 KKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPSSATD-NASKVKIDQG 194

  Fly   217 RPSQPSRT 224
            ||.:.:::
  Fly   195 RPVENTKS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 79/164 (48%)
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 79/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.