DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab23

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:214 Identity:63/214 - (29%)
Similarity:107/214 - (50%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 APYNYNYI--------FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKI 84
            |.|||..:        .|.:|:|:.|||||.::.::.:..|..:...||||:|..|.||:|.:.:
  Fly    22 AQYNYTSMREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDV 86

  Fly    85 KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNK 149
            ::.:|||||||.|..:|::|||||..:::|:..|.|::::.:..|.....|..|....: ::.||
  Fly    87 RIMLWDTAGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNEIPTV-IVQNK 150

  Fly   150 SDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGV 214
            .||.....||.:|.:..|.......:..|.....||...|...|.|.:|.:.:....:..::...
  Fly   151 IDLIEQAVVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNS 215

  Fly   215 QHRP--SQPSRTSLSSEAT 231
            .|.|  |.|:.::.|...|
  Fly   216 SHPPYSSTPTISAFSPTFT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 52/172 (30%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 46/149 (31%)
Rab23_like 50..197 CDD:133306 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.