DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RAB19

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001008749.2 Gene:RAB19 / 401409 HGNCID:19982 Length:217 Species:Homo sapiens


Alignment Length:214 Identity:87/214 - (40%)
Similarity:128/214 - (59%) Gaps:6/214 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 91
            ||..|::|:||.|:|||..|||:|::..|....:.....:||||:|..|.:::|.||:|:|:|||
Human     9 AADENFDYLFKIILIGDSNVGKTCVVQHFKSGVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDT 73

  Fly    92 AGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTR 156
            |||||||.:|:||||.|..|::.||:|||||:..:..|:.:.......:.||.|||||.||...|
Human    74 AGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESIPHWIHEIEKYGAANVVIMLIGNKCDLWEKR 138

  Fly   157 EVTYEEAKEFADENGLM-FLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQ 220
            .|.:|:|...|::.||: .||.||...:|:||.|:..|:::   |....|.| ..||.:...|..
Human   139 HVLFEDACTLAEKYGLLAVLETSAKESKNIEEVFVLMAKEL---IARNSLHL-YGESALNGLPLD 199

  Fly   221 PSRTSLSSEATGAKDQCSC 239
            .|.. |.::....|..|:|
Human   200 SSPV-LMAQGPSEKTHCTC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 73/165 (44%)
RAB19NP_001008749.2 Rab19 15..179 CDD:133267 73/163 (45%)
Effector region. /evidence=ECO:0000250 46..54 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.