DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and rab5ab

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_957264.1 Gene:rab5ab / 393945 ZFINID:ZDB-GENE-040122-3 Length:216 Species:Danio rerio


Alignment Length:217 Identity:79/217 - (36%)
Similarity:122/217 - (56%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PNMTAAPYNYNYI--FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIK 85
            ||   .|...|.|  ||.:::|:..||||.|:.:|.:.:|......|||..|.|:.:.:||..:|
Zfish    10 PN---GPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVK 71

  Fly    86 LQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKS 150
            .:|||||||||:.::...|||||..|::|||||...::....:|:.:.:...:|:.||.|.|||:
Zfish    72 FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKA 136

  Fly   151 DLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQ 215
            ||.:.|.:.:::|:.:||:|.|:|:|.||.|..||.|.|:..|:|:.:|..:......|...|| 
Zfish   137 DLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVSEIFMAIAKKLPKNEPQPAGANTARNRGV- 200

  Fly   216 HRPSQPSRTSLSSEATGAKDQC 237
                     .|:..|..||..|
Zfish   201 ---------DLTETAQPAKGPC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 66/166 (40%)
rab5abNP_957264.1 Rab5_related 21..183 CDD:206653 65/161 (40%)
Ras 23..184 CDD:278499 64/160 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.