DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab19

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:205 Identity:82/205 - (40%)
Similarity:128/205 - (62%) Gaps:13/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQE 95
            :::::||.::|||.|.||:|::.:|....::....:||||:|..:.|.|:.|:||||||||||||
  Fly    17 HFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQE 81

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTY 160
            |||.:|:||||.|.|.|:|||||:||::::|..|:.:.|..|..:.:|.|:|||.|||..|||.:
  Fly    82 RFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREVDF 146

  Fly   161 EEAKEFAD--ENGLMFLEASAMTGQNVEEAFLETARKIYQ-----NIQEGRLDLNASESGVQHRP 218
            |||::...  ...|..:|.||....|||:||...|.::.:     |::|      ..|:.:....
  Fly   147 EEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEE------VPENTITLGQ 205

  Fly   219 SQPSRTSLSS 228
            .:|.::..||
  Fly   206 GKPLKSCSSS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 76/171 (44%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 76/164 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.