DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RabX5

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:222 Identity:66/222 - (29%)
Similarity:104/222 - (46%) Gaps:29/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVT 101
            |.|.:||..|||:.::::|...||.:|...||||:|......:......|::||||||||||.:.
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIA 130

  Fly   102 RSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNL-TNPSTVIFLIGNKSDLESTREVTYEE--- 162
            .:|||.|:..::.||::::.:......||....|. .:...::||:|.|:||.|..|....|   
  Fly   131 GAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLA 195

  Fly   163 ---AKEFADENGLMFLEASAMTGQNV------------EEAFLETARKIYQNIQEGRLDLNASES 212
               |.|...|    :...||.:|..|            |||.::..|.|....||     .|:::
  Fly   196 GLAAAELQAE----YWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQE-----QATQA 251

  Fly   213 GVQHRPSQPSRTSLSSEATGAKDQCSC 239
            .|:.: :...|....|..:..|..|:|
  Fly   252 SVKSQ-TFDLRNFFGSRLSQQKSGCTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 57/180 (32%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 52/167 (31%)
RAB 66..225 CDD:197555 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.