DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and RabX6

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:209 Identity:71/209 - (33%)
Similarity:115/209 - (55%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KYIIIGDMGVGKSCLLHQFTEKKFMANCPH--TIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRA 99
            |.|:.||.|||||.|..:|....|:.:...  |:|::...|...|::|:||||:|||.|.||..:
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly   100 VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTR-EVTYEEA 163
            ||.|||:.|.||::|:.:...::::.||..|.|...... :..||:.||||||:... ||:.||.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYAE-NAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   164 KEFADENGLMF---LEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTS 225
            :.|.::...:.   .:.|..:|..|||.|.:.:|::. :....:::|.|    ::|:..|.. |:
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQLV-HANRSKMELQA----LEHKSFQVD-TA 197

  Fly   226 LSSEATGAKDQCSC 239
            .|..||..:|..||
  Fly   198 SSGAATNEEDASSC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 60/167 (36%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 60/167 (36%)
Rab 10..172 CDD:206640 59/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.