DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab3

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:218 Identity:74/218 - (33%)
Similarity:122/218 - (55%) Gaps:15/218 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDT 91
            ||..|::|:||.:|||:..|||:..|.::.:..|.:....|:|::|..:.:...||::|||||||
  Fly    13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDT 77

  Fly    92 AGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTR 156
            |||||:|.:|.:|||||.|.:::||:|...::|.:..|:|..:..:..:..:.|:|||.|:|..|
  Fly    78 AGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQR 142

  Fly   157 EVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLD-----LNASESGVQH 216
            .:::|..::.||:.|:.|.|.||....||:..|......|...:.|. ||     :...:.| |.
  Fly   143 VISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSES-LDADPTLVGGGQKG-QR 205

  Fly   217 RPSQPSRTSLSSEATGAKDQCSC 239
            ...||..|..::        |:|
  Fly   206 LTDQPQGTPNAN--------CNC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 61/164 (37%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 60/163 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.