DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab32

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:225 Identity:76/225 - (33%)
Similarity:122/225 - (54%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKI-KLQI 88
            ||:......:::|.::||::|.||:..:.::..:.|..|...||||:|..::::.|...| :||:
  Fly   473 MTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQL 537

  Fly    89 WDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRN---LTNPSTV-IFLIGNK 149
            ||.||||||..:||.||:.|.||.:|:|:||..|::.:|.|..|..:   |.:.|.: ..|:.||
  Fly   538 WDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANK 602

  Fly   150 SDLESTREVTY-EEAKEFADENGLM-FLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASES 212
            .|.|....:|. |:..|:..|||.. :.|.||....|::||......||..|.:....||     
  Fly   603 CDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADL----- 662

  Fly   213 GVQHRPSQPSRTSLS-SEATG--AKDQCSC 239
                  :...:.:|| ::|||  ||::|||
  Fly   663 ------ADGDKFNLSAADATGSDAKNKCSC 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 61/171 (36%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 72/212 (34%)
RAB 484..652 CDD:197555 60/167 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.