DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab9

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:167 Identity:61/167 - (36%)
Similarity:96/167 - (57%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAG 93
            |...:.:.|.:|:||.|||||.||.:|...::..|..|||||||..:.|.||.::..||||||||
  Fly     6 PPQKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAG 70

  Fly    94 QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF---LIGNKSDLES- 154
            ||||||:...:|||:...|:.|.:..|.:...|..|..:..|..:.....|   ::|||:|:.: 
  Fly    71 QERFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQ 135

  Fly   155 TREVTYEEAKEF-ADENGLMFLEASAMTGQNVEEAFL 190
            .|:|:.:..::: |::.....:|.|:....||.:||:
  Fly   136 KRQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 60/162 (37%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 60/165 (36%)
Ras 14..177 CDD:278499 60/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.