DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab6

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001285869.1 Gene:Rab6 / 34636 FlyBaseID:FBgn0015797 Length:208 Species:Drosophila melanogaster


Alignment Length:211 Identity:71/211 - (33%)
Similarity:113/211 - (53%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAV 100
            ||.:.:|:..|||:.|:.:|....|......|||::|.::.:.::|:.::||:||||||||||::
  Fly    13 FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 77

  Fly   101 TRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKE 165
            ..||.|.:..|::|||||..::::..|.|:.|.|.......:|.|:|||:||...|:|:.||.:.
  Fly    78 IPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGER 142

  Fly   166 FADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPS----RTSL 226
            .|.|..:||:|.||..|.||::.|...|               |:..|:....::||    ...|
  Fly   143 KAKELNVMFIETSAKAGYNVKQLFRRVA---------------AALPGMDSTENKPSEDMQEVVL 192

  Fly   227 SSEATGAKDQ---CSC 239
            .......||.   |:|
  Fly   193 KDSPNETKDPEGGCAC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 62/162 (38%)
Rab6NP_001285869.1 Rab6 13..173 CDD:206654 63/174 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.