DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab21

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:208 Identity:73/208 - (35%)
Similarity:119/208 - (57%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDD-KKIKLQIWDTAGQERFRA 99
            ||.:::|:..|||:.|:.::.|.:|.|....|:...|.:|.:.::| ::.:|.||||||||||.|
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly   100 VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAK 164
            :...||||:.|||:|||||.|.::..:.||:.:.|.:......:.::|||:|||..|.||::||.
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   165 EFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRTSLSSE 229
            ::|...|..::|.||...:.|.|.|....:.:.:.:.:.:.|  ||...:|:..:.....|..||
  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPD--ASPLRLQNPDTDNLNNSDDSE 206

  Fly   230 ATGAKD---QCSC 239
            |....|   |.||
  Fly   207 APDPGDPAGQRSC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 61/163 (37%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 61/161 (38%)
Ras 15..177 CDD:278499 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.