DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab9b

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_795945.1 Gene:Rab9b / 319642 MGIID:2442454 Length:201 Species:Mus musculus


Alignment Length:218 Identity:77/218 - (35%)
Similarity:116/218 - (53%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRA 99
            :.|.|::||.|||||.|::::...||.:...|||||||..|.:|||.:.:.||||||||||||::
Mouse     7 LLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKS 71

  Fly   100 VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTD---TRNLTNPSTVIFLI-GNKSDLESTREVTY 160
            :...:||||...|:.:.:..|.::.:|.:|..:   ..::.:|....|:: |||.|.|. |:||.
Mouse    72 LRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPDHFPFVVLGNKVDKED-RQVTT 135

  Fly   161 EEAKEFADENG-LMFLEASAMTGQNVEEAFLETARKIYQNIQE--------GRLDLNASESGVQH 216
            |||:.:..||| ..:||.||....||..||.|..|::.. ::|        ..:|||        
Mouse   136 EEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLA-VEEQLEHCMLGHTIDLN-------- 191

  Fly   217 RPSQPSRTSLSSEATGAKDQCSC 239
                          :|:|...||
Mouse   192 --------------SGSKASSSC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 69/168 (41%)
Rab9bNP_795945.1 Rab9 3..172 CDD:206697 69/165 (42%)
Effector region. /evidence=ECO:0000250 36..44 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.