DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab39

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster


Alignment Length:214 Identity:91/214 - (42%)
Similarity:134/214 - (62%) Gaps:8/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEV-DDKKIKLQIWDTAGQE 95
            :.|.|:.|:|||..||||.||..||:.||......|:||:|..|:||: |..:||||:|||||||
  Fly     6 FEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQE 70

  Fly    96 RFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF-LIGNKSDLEST---R 156
            |||::|:||||.:.|.|:||||:..:::.|:..|:.:.:....|...:| |:|.|.||.:.   |
  Fly    71 RFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHR 135

  Fly   157 EVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQP 221
            |||.|||::||.::||.|:|.||.:|.||||||....:::|..|:.|.........|::...|:|
  Fly   136 EVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRP 200

  Fly   222 SRTSLSSEATGAK-DQCSC 239
            :  ||......|: ::.||
  Fly   201 N--SLDFNLVVAEPEKSSC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 81/169 (48%)
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 91/212 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.