DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab39a

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001101618.1 Gene:Rab39a / 315668 RGDID:1311286 Length:217 Species:Rattus norvegicus


Alignment Length:212 Identity:91/212 - (42%)
Similarity:137/212 - (64%) Gaps:7/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YIFKYIIIGDMGVGKSCLLHQFTEKKF----MANCPHTIGVEFGTRIIEVD-DKKIKLQIWDTAG 93
            |.|:.|:|||..||||||||:||:.:|    ...|..|:||:|.:|::|:: .|:||||:|||||
  Rat     7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAG 71

  Fly    94 QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF-LIGNKSDLESTRE 157
            |||||::||||||.:.|..:|:|||.|.::.|:..||.:.:....|..::| |:|:|.||.|.|:
  Rat    72 QERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQ 136

  Fly   158 VTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPS 222
            |:.|||::.:.:.|:.::|.||....||||:|...||.||:.|::|.:.:.....||: ....|:
  Rat   137 VSREEAEKLSKDCGMKYIETSAKDATNVEESFTILARDIYELIKKGDICIQDGWEGVK-SGFVPN 200

  Fly   223 RTSLSSEATGAKDQCSC 239
            ....|.||...:.||.|
  Rat   201 TVHSSEEAVKPRKQCFC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 80/170 (47%)
Rab39aNP_001101618.1 Rab39 7..217 CDD:133311 90/210 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.