DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and Rab21

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001004238.1 Gene:Rab21 / 299799 RGDID:1303150 Length:223 Species:Rattus norvegicus


Alignment Length:221 Identity:71/221 - (32%)
Similarity:115/221 - (52%) Gaps:17/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPH--TIGVEFGTRIIEVDDKKIKLQIW 89
            ||.....|.||.:::|:..|||:.|:.::.|.||  |..|  |:...|.|:.:.:..|::.|.||
  Rat     9 AAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKF--NDKHITTLQASFLTKKLNIGGKRVNLAIW 71

  Fly    90 DTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLES 154
            ||||||||.|:...|||.:.||::|||:|...::..:.:|:.:.|.:......:.::|||.|||.
  Rat    72 DTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEK 136

  Fly   155 TREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQNIQ-------EGRLDLNASES 212
            .|.|:.:||:.:|:..|......||...:.:||.||:..:::.:..|       .|.....|:..
  Rat   137 ERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARR 201

  Fly   213 GVQHRPSQPSRTSLSSEATGAKDQCS 238
            |||....:|...|      |:...||
  Rat   202 GVQIIDDEPQAQS------GSGGCCS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 58/166 (35%)
Rab21NP_001004238.1 Rab21 18..179 CDD:133323 57/162 (35%)
Effector region. /evidence=ECO:0000250 46..54 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.