DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab14 and ypt71

DIOPT Version :9

Sequence 1:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_593524.1 Gene:ypt71 / 2543411 PomBaseID:SPAPB1A10.10c Length:208 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:66/210 - (31%)
Similarity:109/210 - (51%) Gaps:18/210 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVT 101
            |.:|:||.||||:||::||..:||......|||.:|.|:.:.||||.:.||:|||||||||:::.
pombe    10 KVVILGDSGVGKTCLMNQFVNQKFSREYKATIGADFLTKDVVVDDKLVTLQLWDTAGQERFQSLG 74

  Fly   102 RSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF---LIGNKSDLE-STREVTYEE 162
            .::||||...::||::....:::.:.:|..:....|:.....|   ::||:.|.: |.|.|:...
pombe    75 MAFYRGADCCVIVYNVNNSKSFDSVENWRQEFLYQTSQDECAFPFIIVGNQIDKDASKRAVSLHR 139

  Fly   163 AKEFADE---NGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRT 224
            |.::...   :.::..||||....||.:.|...:|...:|           ||......:..|..
pombe   140 ALDYCKSKHGSNMIHFEASAKENTNVTDLFETVSRLALEN-----------ESSRDDFVNDFSEP 193

  Fly   225 SLSSEATGAKDQCSC 239
            .|.|:.......|:|
pombe   194 LLLSKPLNNTSSCNC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab14NP_788056.1 Rab14 34..199 CDD:133322 58/168 (35%)
ypt71NP_593524.1 Rab7 9..182 CDD:206655 60/182 (33%)
RAB 9..179 CDD:197555 58/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.